DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpine1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:411 Identity:126/411 - (30%)
Similarity:190/411 - (46%) Gaps:37/411 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGLAL-------FPFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSI 72
            :|||.|       .|....||        |||     ...|.:.|:.::.......|:||||:.:
Mouse    11 ILGLVLVSGKGFTLPLRESHT--------AHQ-----ATDFGVKVFQQVVQASKDRNVVFSPYGV 62

  Fly    73 QTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQ----VLAAYQDSQILRIANKIFVMDG 133
            .:..||.::....:|..|:...:|...:: :..||:..|    ::..:..::| ..|:.|||...
Mouse    63 SSVLAMLQMTTAGKTRRQIQDAMGFKVNE-KGTAHALRQLSKELMGPWNKNEI-STADAIFVQRD 125

  Fly   134 YQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVN 198
            .:|.|.|.....|.|.:..:.||||:..:|...||:|||:.|..:|.||:....::..:||||||
Mouse   126 LELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMISDLLAKGAVDELTRLVLVN 190

  Fly   199 AIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAM---ALELPYKDSD 260
            |::|.|.|:..|.:..|....||.....||.||||:...:|.|.:....|.:   .:||||:...
Mouse   191 ALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQGDT 255

  Fly   261 LSMLIVLPNTK-TGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSR 324
            |||.|..|..| ..|.||...|....:.|...::......|.||:|..|.:|:|....:||||..
Mouse   256 LSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPD 320

  Fly   325 MFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADH 389
            |||........|...|.|.|:..:.|..|||||.||.|:::|...:..:.|      |.|...|.
Mouse   321 MFSATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMA------PTEMVIDR 379

  Fly   390 PFTYVLVHQ-KDLPLFWGSVV 409
            .|.:|:.|. .:..||.|.|:
Mouse   380 SFLFVVRHNPTETILFMGQVM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 115/371 (31%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 121/393 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.