DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpina10

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_598301.2 Gene:Serpina10 / 171154 RGDID:621220 Length:436 Species:Rattus norvegicus


Alignment Length:379 Identity:105/379 - (27%)
Similarity:187/379 - (49%) Gaps:16/379 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL---GLA 98
            |.|:.:...:.|..::..|:|.:..| |::||||.:........|||:.||..|::.||   .|:
  Rat    63 ASQQLSNETSSFGFSLLRKISMRHDG-NVIFSPFGLSVAMVNLMLGAKGETKVQVENGLNLQALS 126

  Fly    99 SSDPEQIAHSFHQVLAAYQDSQILRI--ANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV 161
            .:.|..:...|.:|...:..::.|.:  .:..|:...:::::.:..|.:..|.:.....:|..:.
  Rat   127 QAGPLILPALFKRVKETFSSNKKLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTEYVPTNFRNSS 191

  Fly   162 QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGER 226
            ||...:|:::.:.|...|..|.  |.:|.|::|:||:.|.|||.|...|....|..||||||..:
  Rat   192 QARGLMNHYINKETEGKIPKLF--DEINPETKLILVDYILFKGKWLTPFDPIFTEADTFHLDKYK 254

  Fly   227 TVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQ 291
            .|:||||..:..|............|:|||: .:.:||:||........|||:.|....:....|
  Rat   255 AVKVPMMYREGNFASTFDKKFRCHILKLPYQ-GNATMLVVLMEKSGDHLALEDYLTTDLVEMWLQ 318

  Fly   292 SLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVN 356
            .:...|:.:..|:||...:.|:.|:.:::|:.|:||..|:..::......|:||.::.::.:||:
  Rat   319 DMKTRKMEVFFPKFKLNQRYEMHELLKQVGIRRIFSTSADLSELSAVARNLQVSKVVQQSVLEVD 383

  Fly   357 EEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQ-KDLPLFWGSVV 409
            |.|||..:.|   |....|...|  |: ...|.||.:::..: ..:.||.|.||
  Rat   384 ERGTEVVSGT---VSEITAYCMP--PV-IKVDRPFHFIIYEEMSQMLLFLGRVV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 101/368 (27%)
Serpina10NP_598301.2 SERPIN 66..430 CDD:294093 101/373 (27%)
Heparin-binding. /evidence=ECO:0000250 128..145 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.