DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA12

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:434 Identity:122/434 - (28%)
Similarity:210/434 - (48%) Gaps:65/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PLLGLALF-------------PFPPVHTADVTMADA-----AHQEFARRLALFSINVYGKLSGQK 60
            |.||||:|             .|.|.:...::....     |.:|.||:.......:..||:...
Human     3 PTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYN 67

  Fly    61 PGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVL-AAYQDSQILR- 123
            ||.||..||.||.|..:|..|||::.|..::.||........:.:...||.:: ...|.:|.|: 
Human    68 PGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKL 132

  Fly   124 -IANKIFVMDGYQLRQEF--DQLLSKQFLSAAQSVDFSKNVQ-AAATINNWVEQRT----NHLIK 180
             |.|.:|:....|.:::|  |   :|.|.||...:...:|:: |...||:::.|:|    |:||:
Human   133 SIGNTLFIDQRLQPQRKFLED---AKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIE 194

  Fly   181 DLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFR----- 240
            ::.|..|      ::|.|.|.|:..|:|:|..::|:.:.|.|:...:|:||||     ||     
Human   195 NIDPGTV------MLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMM-----FRSGIYQ 248

  Fly   241 --YADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLP 303
              |.|  .|....||:||: .:::.:.:||: :..|..||:.|::.|.|:....|....|.:.:|
Human   249 VGYDD--KLSCTILEIPYQ-KNITAIFILPD-EGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVP 309

  Fly   304 RFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSP-EPLKVSAIIHKAFIEVNEEGTEAAAATG 367
            |.......:|.:....:|:|::|.:..:..|:  :| ..|||...:|||.::::|.|||.||.||
Human   310 RLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKI--APHRSLKVGEAVHKAELKMDERGTEGAAGTG 372

  Fly   368 MAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLP--LFWGSVV 409
            ...      :..|.|:....|.|: .:|::.:.:|  ||.|.:|
Human   373 AQT------LPMETPLVVKIDKPY-LLLIYSEKIPSVLFLGKIV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 109/382 (29%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 114/397 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.