DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serping1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:408 Identity:114/408 - (27%)
Similarity:186/408 - (45%) Gaps:55/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PFPPVHTADVTMA--DAAHQEFARRLALFSINVYGKLSGQKPGE-NIVFSPFSIQTCAAMARLGA 83
            ||.|...|..:.:  |::..:.:..|..||:.:|...|..|..: |:.||||||.:......|||
Mouse   126 PFCPEPLAQCSDSDRDSSEAKLSEALTDFSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGA 190

  Fly    84 ENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQF 148
            .:.|.:.|:..|    |.|:..| ..||.|..:....:..::         |:....|..:...:
Mouse   191 GDSTKSNLESIL----SYPKDFA-CVHQALKGFSSKGVTSVS---------QIFHSPDLAIRDTY 241

  Fly   149 LSAAQSV----------DFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFK 203
            ::|:||:          |.:.|::   .||.||.:.|||.|:.|:  |.|.|::.|||:||::..
Mouse   242 VNASQSLYGSSPRVLGPDSAANLE---LINTWVAENTNHKIRKLL--DSLPSDTCLVLLNAVYLS 301

  Fly   204 GTWQHQFAKHLTRPDTFHLDGERTVQVPMM-SLKERFRYADLPALDAMA--LELPYKDSDLSMLI 265
            ..|:..|.........|:.:.  .::|||| |:|......|...|.|..  |:|.:   :||.:|
Mouse   302 AKWKITFEPKKMMAPFFYKNS--MIKVPMMSSVKYPVAQFDDHTLKAKVGQLQLSH---NLSFVI 361

  Fly   266 VLP-NTKTGLPALEEKLRLTTLSQITQSLYETK---VALKLPRFKAEFQVELSEVFQKLGMSRMF 326
            |:| ..|..|..:|:.|..|....|.:.|..:|   ..|.:|..|.:...::..|.:||......
Mouse   362 VVPVFPKHQLKDVEKALNPTVFKAIMKKLELSKFLPTYLTMPHIKVKSSQDMLSVMEKLEFFDFT 426

  Fly   327 SDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPF 391
            .|....| :.:.|: |:|||:.|:..:|:.|.|.|||||:.::..|...|        |....||
Mouse   427 YDLNLCG-LTEDPD-LQVSAMKHETVLELTESGVEAAAASAISFGRSLPI--------FEVQRPF 481

  Fly   392 TYVLVHQKD-LPLFWGSV 408
            .::|..|:. .|:|.|.|
Mouse   482 LFLLWDQQHRFPVFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 108/381 (28%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141 4/14 (29%)
serpinG1_C1-INH 141..500 CDD:381006 110/393 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.