DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and SERPINA3

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:429 Identity:127/429 - (29%)
Similarity:201/429 - (46%) Gaps:46/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLPLLGLALF-----------PFPPVHTADVTMAD---AAHQEFARRLALFSINV------YGKL 56
            :||||.|.|.           |..|:...::|..:   ..|.:    |.|.|.||      |.:|
Human     4 MLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVD----LGLASANVDFAFSLYKQL 64

  Fly    57 SGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSDPEQIAHSFHQVLAAY--- 116
            ..:.|.:|::|||.||.|..|...|||.|.|.|::.:||  .|..:...:|..||..:|...   
Human    65 VLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQS 129

  Fly   117 QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKD 181
            .|...|.:.|.:||.:...|...|.:...:.:.|.|.:.||..:..|...||::|:..|...|.|
Human   130 SDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITD 194

  Fly   182 LVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLP- 245
            |:..  |:|::.:||||.|.||..|:..|....|....|:|..::.|.||||||    .:..:| 
Human   195 LIKD--LDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSL----HHLTIPY 253

  Fly   246 ----ALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVA-LKLPRF 305
                .|....:||.| ..:.|.|.:||: :..:..:|..|...||.:...||...::. |.||:|
Human   254 FRDEELSCTVVELKY-TGNASALFILPD-QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKF 316

  Fly   306 KAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAV 370
            .......|:::..:||:...|:.:|:... :.....|.||.::|||.::|.||||||:|||.:.:
Human   317 SISRDYNLNDILLQLGIEEAFTSKADLSG-ITGARNLAVSQVVHKAVLDVFEEGTEASAATAVKI 380

  Fly   371 RRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVV 409
            ....|::.....:.|  :.||..::|......:|:.|.|
Human   381 TLLSALVETRTIVRF--NRPFLMIIVPTDTQNIFFMSKV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 115/379 (30%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 118/393 (30%)
RCL 369..394 8/24 (33%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.