DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and Serpinb7

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:378 Identity:114/378 - (30%)
Similarity:184/378 - (48%) Gaps:24/378 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--------GLASSDP 102
            |.|..:::.::...:...|:.||..||.|..::.||||..:.|.|:|:.|        |.:|:..
  Rat     9 AEFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSSNSQ 73

  Fly   103 EQIAHSFHQVLA----AYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQA 163
            ..:.:...:|||    :::|.: |.|||.:|....:...:.:.:.....:.:..:.|||:.::|.
  Rat    74 LGLQYQLKRVLADINSSHKDYE-LSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDIQE 137

  Fly   164 AA-TINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERT 227
            .. .||.|:|..|:..||.::....|:|.:.:|||||::|||.|:..|.|..|....|.......
  Rat   138 TRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSPSGPG 202

  Fly   228 VQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQS 292
            ..|.||..:.||..:.:.......|||.| ...:||.|:||  :..|..:|.||....|...|.|
  Rat   203 KAVNMMHQERRFNLSTIQEPPMQILELQY-HGGISMYIMLP--EDDLSEIESKLSFQNLMDWTNS 264

  Fly   293 --LYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEV 355
              :....|.:.||:||.|...|:....:.:|:..:|.:.......:.|...|.||.::||:.|||
  Rat   265 RKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSGIASGGRLYVSKLMHKSLIEV 329

  Fly   356 NEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSV 408
            :||||||.|||...:..|   :.||..: |.||.||.:| :.:..:.||.|.|
  Rat   330 SEEGTEATAATESNIVEK---LLPESTV-FRADRPFLFV-IRKNGIILFTGKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 113/376 (30%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 114/378 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.