DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and LOC100909605

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:381 Identity:112/381 - (29%)
Similarity:198/381 - (51%) Gaps:28/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGL--GLASSDPEQIAHSFH 110
            |:.::|.:|..:.|.:|||||.|||.|...:..|||:|.|..::.:||  .|..:...:|...:.
  Rat    44 FAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQGYE 108

  Fly   111 QVLAAYQ---DSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVE 172
            .:|....   |...:...:.:|:....|:..||.:.....:.:.|.|.||.:..:|...||::|.
  Rat   109 HLLQRLNLPGDQVQISTGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHEAKKLINDYVR 173

  Fly   173 QRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE 237
            ::|...||:|:  .||:.::.:||||.|:|||.|:..|..|.|....|:||.:::|:||||.:::
  Rat   174 KQTQGKIKELI--SVLDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVKVPMMKIEK 236

  Fly   238 ----RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKV 298
                .||..:   |....|||.| ..:.|.|.:||: :..:..:|..|:..||.:...:|...::
  Rat   237 LTTPYFRDEE---LSCSVLELKY-TGNASALFILPD-QGRMQQVEASLQPETLRRWKDTLRPRRI 296

  Fly   299 -ALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEA 362
             .|::|:|.....:.|.::..:||:..:||.||:..: :...:.|.||.::|||.::|.|.||||
  Rat   297 DELRMPKFSISTDMRLGDILPELGIREVFSQQADLSR-ITGAKDLSVSQVVHKAVLDVTETGTEA 360

  Fly   363 AAATGMAVRRKRAIMSPEEPIEFFADHPFTYVL----VHQKDLPLFWGSVVRLEEN 414
            |||||:.:   ..:.:....:..:.:.||..::    .|   :.||...|...:|:
  Rat   361 AAATGVKI---IPMCAKFYYVTMYFNRPFLMIISDTNTH---IALFMAKVTNPKED 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 110/373 (29%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 110/373 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.