DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpinf2

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_002937193.2 Gene:serpinf2 / 100170598 XenbaseID:XB-GENE-877015 Length:594 Species:Xenopus tropicalis


Alignment Length:387 Identity:112/387 - (28%)
Similarity:192/387 - (49%) Gaps:51/387 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPE 103
            ::|::.:..|||::..::..:....::|.|||||........|||..|...:|.:.|.:.|    
 Frog   217 RKFSQAITFFSIDLLKEIDPESKKPSVVMSPFSIALGLLQLSLGAGKEMQNKLMETLHVES---- 277

  Fly   104 QIAHSFHQVLAAYQ---DSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFS--KNVQA 163
              .|..|..|...:   ...|||.|.:|::..|:|::..|.:...|.:.|....:..|  ||:: 
 Frog   278 --LHCLHNKLKTVRKELSKSILRTATRIYLKKGFQIKDSFLKSSEKWYGSKPLHLGGSKKKNLE- 339

  Fly   164 AATINNWVEQRTN----HLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDG 224
              :||.||:..|.    |.:.|| |.|||     |:|:||:||||.|::.|...||..|:|:::.
 Frog   340 --SINKWVKDITEGQIPHFLSDL-PQDVL-----LILLNAMHFKGVWKNTFDPSLTSEDSFYIND 396

  Fly   225 ERTVQVPMMSL-KERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKT-GLPALEEKLRLTTLS 287
            :.:|.|.|||. |..|.:..|.::::...:..:| .::|.::::|.:.| .|..|        |:
 Frog   397 DMSVPVEMMSAQKYPFSWFFLESIESQVAKFQFK-GNMSFVVLMPYSSTWNLSKL--------LA 452

  Fly   288 QITQS-LY-----ETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSA 346
            ..:|| ||     |....||:|:...::::||......||:.::|::....|   .:.|.|.||:
 Frog   453 NFSQSDLYSRFPREKNTNLKMPKLNLDYKLELRNPLTNLGLGQLFTNPDLSG---ITNEALVVSS 514

  Fly   347 IIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSV 408
            |.|::.:|:||||.||:|.|.:...|..::.....|..||       :......:|||.|.|
 Frog   515 IQHQSSLELNEEGVEASAVTAVITSRSHSVYRINRPFLFF-------LFEDTMGIPLFMGHV 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 110/379 (29%)
serpinf2XP_002937193.2 PRK12495 <18..>140 CDD:183558
PHA03169 <89..>215 CDD:223003
serpinF2_A2AP 212..574 CDD:381009 112/387 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.