DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpine1

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:358 Identity:106/358 - (29%)
Similarity:183/358 - (51%) Gaps:17/358 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQL--DQGLGLASSDPEQIAHSFH 110
            |.:.|:.:.....|..|:..||:.|.:...||::||...|...|  ..|..|......::.....
Zfish    28 FGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGAYGATLKLLASKMGYSLQERGMPKLQRLLQ 92

  Fly   111 QVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRT 175
            :.||: :|.  :.:|:.:.|.....|.:.|.:.|||.|.|....:|||:...|...||:|....|
Zfish    93 RDLAS-EDG--VEVASGVMVDRKIILEKVFRRSLSKAFQSVPHQIDFSQPEMARQVINSWTSDHT 154

  Fly   176 NHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFR 240
            :.:|.:.:|:.||:..:|||.:||:||.|.|:..|....||...||......|.||||:..::|.
Zfish   155 DGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQLFHTVNGSAVSVPMMTTTQKFN 219

  Fly   241 YADLPALDAM---ALELPYKDSDLSMLIVLPNTK-TGLPALEEKLRLTTLSQITQSLYETKVALK 301
            |.:..:.|.:   .:|:||:...:|||:|.|..| ..|.||.::|..:.:.|..|.:.:....|.
Zfish   220 YGEFVSKDGVDYDVIEMPYEGESISMLLVTPFEKDVPLSALNKELSSSRIHQWRQEMRKISKQLS 284

  Fly   302 LPRFKAEFQVELSEVFQKLGMSRMFS-DQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAA 365
            :|||..:.:::|.....::|:..:|| .:|:|.: :.:.|||.||.::.:..:|||||||:.::|
Zfish   285 IPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFSR-ITTEEPLCVSKVLQRVKLEVNEEGTKGSSA 348

  Fly   366 TGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQ 398
            |...:..:.|:.      |...|.||.:::.|:
Zfish   349 TAAVIYSRMAVE------EITLDRPFFFLIQHK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 106/358 (30%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 106/358 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.