DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Da and serpina10b

DIOPT Version :9

Sequence 1:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:393 Identity:118/393 - (30%)
Similarity:199/393 - (50%) Gaps:33/393 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MADAAHQE--------FARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETAT 89
            :..|.|:|        .|.|...|:||:|.|:|... ..|:||||.|:.||.:...|.|:..|.|
Zfish    15 LCSAEHEELRTPDISDLAFRNTDFAINLYRKISSLH-DRNVVFSPLSVSTCFSALLLAAQGSTRT 78

  Fly    90 QLDQGLGLASSD-------PEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQ 147
            ::.:||.|.:.|       || :....||.::...:.     ...:|:...:.|:..|.|.:.:.
Zfish    79 EILKGLNLEALDGGDSRRVPE-LFQQLHQNISLQMEQ-----GTALFLDQHFHLQTNFSQQIQRF 137

  Fly   148 FLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAK 212
            |.:....|||||.....:.||.:|.::|...:.:::  :.:...::::|:|.|.:||.|:..|..
Zfish   138 FNAEVLRVDFSKPAVCRSLINEFVSRKTGRKVLEML--ESVEPLTQMLLLNTIFYKGDWERPFNP 200

  Fly   213 HLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPAL 277
            :.|....|::|....||||||.|:|:|...:...|.|..|.|||: ...||||:||:......|:
Zfish   201 NNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARVLRLPYR-GGASMLILLPSADADYTAI 264

  Fly   278 EEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPL 342
            |:::....|....:::...|:.:.||||:.:....:.|:..:||:|.:|.|.|:...:.:... |
Zfish   265 EDEISAERLHGWIKNMRRMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAH-L 328

  Fly   343 KVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLP-LFWG 406
            |||.::|||.|||.|:||.||::|.:      .|.:...|..|..:.||.:.|.|::... ||.|
Zfish   329 KVSQVLHKAVIEVYEQGTSAASSTSV------GITAYSLPDTFIINRPFFFFLYHEETASLLFMG 387

  Fly   407 SVV 409
            .|:
Zfish   388 RVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 112/370 (30%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 113/373 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.