DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb6c

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:410 Identity:123/410 - (30%)
Similarity:203/410 - (49%) Gaps:58/410 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE- 99
            |.:....||:::|.::.:.. ::|||.||.|...||::...|:.|.|..::.:.|.|....|.| 
Mouse     5 LLEANATFALNLLKILGEDR-SKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSED 68

  Fly   100 -VVRSAY--ILEKMNRKERQSKMPLEFSSADRIF----------FANDLHVTECARNRLAE-EVQ 150
             .|...:  :|.::|:...|..:    .:|:|:|          |.:..|       :..| |::
Mouse    69 GDVHQGFQLLLSEVNKTGTQYSL----KAANRLFGEKTFDILASFKDSCH-------KFYEAEME 122

  Fly   151 QIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVP 215
            ::|||..||:||:.||.|:||:|.|:|:.:||...|...|.|:|.||.|.||:|..||..|.|..
Mouse   123 ELDFKGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTRE 187

  Fly   216 MPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLIL 280
            |||..|.:....|.||.||.||.:...|::...:|.|||               ..::::|:::|
Mouse   188 MPFKVSKNEEKPVQMMFQKSTFKMTYVEEISTKILLLPY---------------VGNELNMIIML 237

  Fly   281 PPFNSNSLEDV-LSRLNADSLDDS------LKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSK 338
            |.      |.| ||.:..:...:.      |.:....::||.||.|:.|:..::..:|.|:|::.
Mouse   238 PD------EHVELSTVEKEITHEKFIEWTRLDRMKGEKVEVFLPWFKLEENYDMKDVLCKLGMTD 296

  Fly   339 MFDESVATFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFL 402
            .|:|..|.|..::| :.:.:.:..|.:.::|:||||.|.|||.:....|:|.. |. |..|.||:
Mouse   297 AFEEGRADFSGISSKQGLFLSNVIHKSVVEVNEEGSEATAATTIVLKGSSRST-PC-FCVNRPFI 359

  Fly   403 FVIYDRTSRSILFTGIYRDP 422
            |.|....:..|||.|....|
Mouse   360 FFIQHIKTNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 121/402 (30%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 122/408 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.