DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINB11

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:408 Identity:124/408 - (30%)
Similarity:206/408 - (50%) Gaps:54/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD---------WADSK 98
            |.:.:...:..:...:|:|||..|..:||.:...|:.|:||::|.||||..         :.||.
Human    11 FCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKDSP 75

  Fly    99 EVVRSAYILEKMNRKERQSKMPLEFSSADR------IFFANDLHVTE----------CARNRLAE 147
            :..::..|         .|:..:|||..::      :..||.|:.|:          |:......
Human    76 KCSQAGRI---------HSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQA 131

  Fly   148 EVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEK 212
            .:|.:||:..|||:||.||.|:..:|:.::.|:.....|.|.:.:||.||.|.||||.::|:..:
Human   132 RLQTVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRE 196

  Fly   213 TVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMV 277
            ||..||..|......|.||.|.|||.|...::.:..||:|||               .|:.:||:
Human   197 TVKSPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPY---------------VNNKLSMI 246

  Fly   278 LILPPFNSNSLEDVLSRLNADSLDD--SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMF 340
            ::||...:| |:.:..:||:.:..:  |....|.||:||.||:|:.|.:.|||.:|..:||:.:|
Human   247 ILLPVGIAN-LKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLF 310

  Fly   341 DESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFV 404
            ::..|....:: ::.:.:..:.|.:.:.|.|||:.|||||.......:.|:. |:|:.||||||.
Human   311 NQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAATGDSIAVKSLPMR-AQFKANHPFLFF 374

  Fly   405 IYDRTSRSILFTGIYRDP 422
            |....:.:|||.|....|
Human   375 IRHTHTNTILFCGKLASP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 123/403 (31%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 123/406 (30%)
RCL. /evidence=ECO:0000250 341..365 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.