DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINH1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:436 Identity:95/436 - (21%)
Similarity:170/436 - (38%) Gaps:52/436 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILSISLMAVLPAIALAGLCG----VEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFS 63
            :|..:|.|.:...|.|...|    :.|.|..|.:|      ....|.|:...:.:....||:..|
Human    12 LLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAER------SAGLAFSLYQAMAKDQAVENILVS 70

  Fly    64 PYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-------VRSAYILEKMNRKERQSKMPL 121
            |.....:|.|...|....|..:...||..:....:||       :||   |.....:....|:..
Human    71 PVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRS---LSNSTARNVTWKLGS 132

  Fly   122 EFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEI 186
            .......:.||:|.  ...::.....|..:|:|:.: ..:.:.||:|.|:.|..::..:....|.
Human   133 RLYGPSSVSFADDF--VRSSKQHYNCEHSKINFRDK-RSALQSINEWAAQTTDGKLPEVTKDVER 194

  Fly   187 TPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQ 251
            |....||  ||.:.|..|..:|..:......|..:.|....|.||.:.|.:....||:.:..:::
Human   195 TDGALLV--NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVE 257

  Fly   252 LPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSL 316
            :|..                ..:|.::||.|.:...||.:...|..:.|...:.:...:.:.:||
Human   258 MPLA----------------HKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISL 306

  Fly   317 PKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGSTAAAATV 380
            ||...|...:|...||.:|:::..|::.|....:: .:.:.:....|....::|.:|:.      
Human   307 PKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNP------ 365

  Fly   381 LF---TYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
             |   .|.......|..|..:|||:|::.|..|.|:||.|....||
Human   366 -FDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 83/390 (21%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 89/412 (22%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.