DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINA6

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:436 Identity:101/436 - (23%)
Similarity:190/436 - (43%) Gaps:46/436 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHILSISLMAVLPAIALAGLCGVEPDAGLLDQRLNLYKG----QQNFAVSMLNVIRQSTPNENVF 61
            |.:|..:.:..||...|..:..::|:|..::.. |.::|    ..:||.|:...:...:|.:|:|
Human     1 MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMS-NHHRGLASANVDFAFSLYKHLVALSPKKNIF 64

  Fly    62 FSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAYILEKMNRKERQSKMPLEFSS 125
            .||.|...||.:...|:.|.|..:|.:.|..:..:..|. :...:  :.:::...:|...||.:.
Human    65 ISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGF--QHLHQLFAKSDTSLEMTM 127

  Fly   126 ADRIFFANDLHVTEC----ARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEI 186
            .:.:|....|.:.|.    .::....||..::|:.....|| |||.::..:|..:|.::.|.  :
Human   128 GNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASR-QINSYVKNKTQGKIVDLFSG--L 189

  Fly   187 TPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQ 251
            .....|||.|..:.||.|...|....|....||...:....|.||.|..|.....|.:|...::|
Human   190 DSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQ 254

  Fly   252 LPY---RTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIE 313
            :.|   .|||                   .|||  :...:..|::.|:.|:::.........:::
Human   255 MNYVGNGTVF-------------------FILP--DKGKMNTVIAALSRDTINRWSAGLTSSQVD 298

  Fly   314 VSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSK--HVAKIKVDEEGSTAA 376
            :.:||.......:|..:|.:||::.:|... |.|..:|.:. .:..||  |.|.::::|||...|
Human   299 LYIPKVTISGVYDLGDVLEEMGIADLFTNQ-ANFSRITQDA-QLKSSKVVHKAVLQLNEEGVDTA 361

  Fly   377 AATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .:|.:....:::|:   ....|.||:.:|:|..:.|.||.....:|
Human   362 GSTGVTLNLTSKPI---ILRFNQPFIIMIFDHFTWSSLFLARVMNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 92/393 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 91/389 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.