DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and AT1G51330

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:127 Identity:35/127 - (27%)
Similarity:62/127 - (48%) Gaps:9/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LAEEVQQIDFK--SQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQ 207
            |::|.:::...  :..||.|.::|.|..:.|:..|:|:|....:|.:|..:..||.|.||.|.::
plant    17 LSKEAKEVVHAAVNGAEEVRMEVNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENK 81

  Fly   208 FKTEKTVPMPFYTSPSNYSLVSMM---QQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDS 266
            |....|:..||:.......||..|   ::|.....|..:.||  :||  ||..::...::.|
plant    82 FGKSMTIHKPFHLVNGKQVLVPFMKSYERKYMKAYNGFKVLR--ILQ--YRVDYKDTSRQFS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 35/127 (28%)
AT1G51330NP_175544.1 SERPIN <11..>139 CDD:294093 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.