DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina7

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:423 Identity:104/423 - (24%)
Similarity:176/423 - (41%) Gaps:71/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLDQRLNLYKG---QQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL 90
            |..|...|||.   ..:||..:...:....|:.|:||||.|...||.:..|||...|:.::.:||
  Rat    43 LPQQNATLYKMPSINADFAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVL 107

  Fly    91 HLDWADS--KEVVRS-AYILEKMNRKERQSKMPLEFSSADRIFFANDL----HVTECARNRLAEE 148
            ..:..|:  ||:.:. .:::..:|....:    ||....:.:|....|    ...:..:.....|
  Rat   108 GFNLTDTPVKELQQGFQHLICSLNFPNNE----LELQMGNAVFIGQQLKPLAKFLDDVKTLYETE 168

  Fly   149 VQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKT 213
            |...|| |....::.:||.::.|||..:|..::  .::.....::|.|..:.|.||.:.|:..||
  Rat   169 VFSTDF-SNVSAAQHEINSYVEKQTKGKIVGLI--QDLKLNIIMILVNYIHFKAQWANPFRVSKT 230

  Fly   214 VPMPFYTSPSNYSL-------VSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDEN 271
                  ...||:|:       |.||.|...:...||.:|...|||:.|                :
  Rat   231 ------EESSNFSVDKSTTVQVPMMHQLEQYYHYVDVELNCTVLQMDY----------------S 273

  Fly   272 SDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGV 336
            ::...:.:||  ....:|.|.:.:::.:|...........:|:.:|||......:|...|.|||:
  Rat   274 ANALALFVLP--KEGHMEWVEAAMSSKTLKKWNHLLQKGWVELFVPKFSISATYDLGSTLQKMGM 336

  Fly   337 SKMFDESVATFDDLTSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARP---------VE 391
            ...|.|| |.|..:|.:. :.:..:.|.|.:.:.|||          |...|.|         |.
  Rat   337 RDAFAES-ADFPGITKDNGLKLSYAFHKAVLHIGEEG----------TKEGASPEAGSLDQPEVA 390

  Fly   392 P--AKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            |  |....:..||.:|.::.:||:||.|...||
  Rat   391 PLHAVIRLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 97/408 (24%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 102/418 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.