DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SRP2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:433 Identity:113/433 - (26%)
Similarity:184/433 - (42%) Gaps:98/433 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRLNLYKGQQN-FAVSML---NVIRQSTPNENVFFSPYS---------------TYHALLLAYFG 77
            |::::.:..:| ..||:|   .||.....|.|..|||.|               |..:.:|::..
plant    27 QKIDMQEAMKNQNEVSLLLVGKVISAVAKNSNCVFSPASINAVLTVTAANTDNKTLRSFILSFLK 91

  Fly    78 SSGDTE-----KELAKVLHLDWADSK----EVVRSAYILEKMNRKERQSKMPLEFSSADRIFFAN 133
            ||...|     .|||.|:..|.:::.    ..|...::.:.::.......:.|.|..|.   || 
plant    92 SSSTEETNAIFHELASVVFKDGSETGGPKIAAVNGVWMEQSLSCNPDWEDLFLNFFKAS---FA- 152

  Fly   134 DLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAA 198
                             ::||:.:.||.|..:|.|.::.|:|.|:.:|....:|..|..:..||.
plant   153 -----------------KVDFRHKAEEVRLDVNTWASRHTNDLIKEILPRGSVTSLTNWIYGNAL 200

  Fly   199 YLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQ-LRAH----VLQLPYRTVF 258
            |.||.|...|....|...||:.  .|...||:     .|:.:.::| :.|:    ||:||||   
plant   201 YFKGAWEKAFDKSMTRDKPFHL--LNGKSVSV-----PFMRSYEKQFIEAYDGFKVLRLPYR--- 255

  Fly   259 ESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRL--NADSLDDSLKQAMPREIEVSLPKFEF 321
              |.::|:    |.:.||.|.||. ....|:::|.|:  |...||..:.:......:..:|||:.
plant   256 --QGRDDT----NREFSMYLYLPD-KKGELDNLLERITSNPGFLDSHIPEYRVDVGDFRIPKFKI 313

  Fly   322 EQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSKH-VAKIKVDEEGSTAAAATVLFTYR 385
            |...|.:.:                |:|     ..:..|.| .|.|::||||:.|||||.:....
plant   314 EFGFEASSV----------------FND-----FELNVSLHQKALIEIDEEGTEAAAATTVVVVT 357

  Fly   386 SARPVEPAK---FECNHPFLFVIYDRTSRSILFTGIYRDPKTI 425
            .:...||.|   |..:|||||:|.:..:.::||.|...||..:
plant   358 GSCLWEPKKKIDFVADHPFLFLIREDKTGTLLFAGQIFDPSEL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/418 (26%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 110/419 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.