DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpind1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:415 Identity:115/415 - (27%)
Similarity:192/415 - (46%) Gaps:66/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRLNLYKGQQNFAVSMLNVIR-QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHL-DW 94
            ||||:...:  ||.::..|:: |:|.::|:|.:|.....|:.:...|..|:|.:|:..|||. |:
  Rat   104 QRLNILNAK--FAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDF 166

  Fly    95 --ADSKEVVRS-----------------AYILEKMNRKERQSKMPL--EFSSADRIFFANDLHVT 138
              |.||..|.:                 .|.|:.:|....|.:.|:  :|.:|.|.|:       
  Rat   167 VNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFY------- 224

  Fly   139 ECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQ 203
                   ..|.|:.||......|:  .|..|.|.|...|:..|  :.....|::::.|..|.||.
  Rat   225 -------FAEAQEADFSDPAFISK--ANSHILKLTKGLIKEAL--ENTDSATQMMILNCIYFKGA 278

  Fly   204 WLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSP 268
            |:::|..|.|....|..:......|||||.||.||...|::|...:|||.|              
  Rat   279 WMNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY-------------- 329

  Fly   269 DENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAK 333
              ...|||::::|. ..:.::.:.::|....::...|....|..||.||||:.|:...|..:|..
  Rat   330 --VGGISMLIVIPR-KLSGMKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKS 391

  Fly   334 MGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVL-FTYRSARPVEPAKFEC 397
            ||::|:|::: .....::.:.|.|...||.:.|.|:|||:.|||.|.: |...|.:    .:|..
  Rat   392 MGITKLFNKN-GNMSGISDQRIIIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQ----VRFTV 451

  Fly   398 NHPFLFVIYDRTSRSILFTGIYRDP 422
            :.||||::|:..:..:||.|...:|
  Rat   452 DRPFLFLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/403 (27%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 115/415 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.