DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina9

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:390 Identity:98/390 - (25%)
Similarity:169/390 - (43%) Gaps:35/390 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL--HLDWADSKEV-VRSA 104
            |:..:...:.|..|.:|:.|||.|...:|.:...|:...|:.::.:.|  :..|.....: :...
Mouse    53 FSFLLYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFE 117

  Fly   105 YILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAE----EVQQIDFKSQTEESRKQI 165
            |::..:| |..|.:   |......:|...:|.:.....:|:.:    :|...|| |....::.||
Mouse   118 YLVRSLN-KCHQGR---ELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDF-SNAATAQAQI 177

  Fly   166 NDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKT-VPMPFYTSPSNYSLVS 229
            |.::.|:|..::.:::  .::..:|.:||.|..:.|..|...|.|..| ...||..|......|.
Mouse   178 NSYVEKETKGKVVDVI--QDLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVP 240

  Fly   230 MMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSR 294
            ||.|..:|...||::|...:||:.||                .|.....:||  ....:..:...
Mouse   241 MMHQTESFAFGVDKELGCSILQMDYR----------------GDAVAFFVLP--GKGKMRQLEKS 287

  Fly   295 LNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIG 358
            |:|..|....:....|.|:|.:|||.......|..||.|||:...|: |.|.|..:| :..:.:.
Mouse   288 LSARRLRKWSRSLQKRWIKVFIPKFSISASYNLETILPKMGIRDAFN-SNADFSGITKTHFLQVS 351

  Fly   359 DSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPK 423
            .:.|.|.:.|.|||:.|||||.......:|....:......|||.::.|:.:.|:||.|...:|:
Mouse   352 KAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENPR 416

  Fly   424  423
            Mouse   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 97/384 (25%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 97/384 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.