DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina1f

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:401 Identity:70/401 - (17%)
Similarity:158/401 - (39%) Gaps:59/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD------------- 93
            |.::::...:.|.:.|.|:.|||.....|:.:...||:|:..|.:.:.|..:             
Mouse    50 NVSITLFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEAEIHKCF 114

  Fly    94 WADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDL----HVTECARNRLAEEVQQIDF 154
            |          |:|..::    |::.|....:...:|...||    ...:..::....::..|:|
Mouse   115 W----------YLLHSIH----QTEEPSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINF 165

  Fly   155 KSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFY 219
             :.:.:::.|||:::.:::..:|.|::.  .:...|.|.:.|......:..|.|.........::
Mouse   166 -TDSSQAKTQINNYVMEKSQKEIVNIVK--NLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYH 227

  Fly   220 TSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFN 284
            ........|.|:.......|...|.|.:.||.|...|               .:.:...|:|  :
Mouse   228 LGYGMTIKVPMIHNMAMHYLFRVEDLSSTVLMLTLLT---------------GNFATYFIIP--D 275

  Fly   285 SNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFD- 348
            ...::.|...|.........:|.:.|.:::.:|:....:..:|..:::.:|::.:|:....:.| 
Mouse   276 PGKMQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDM 340

  Fly   349 -DLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRS 412
             |...::..:...   |.:.:||:||..:..:   .::.....:..:.:.|.|||..|.|.|:..
Mouse   341 NDTLQKSFKVVSK---AVLTIDEKGSKPSTNS---CFKKLGSTDMGRMQLNRPFLIFIQDHTNDV 399

  Fly   413 ILFTGIYRDPK 423
            .||.|...:|:
Mouse   400 PLFLGRVVNPQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 69/395 (17%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 69/398 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.