DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina12

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:442 Identity:115/442 - (26%)
Similarity:204/442 - (46%) Gaps:77/442 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAGLCGVEPDAGLLDQ-----------RLNLYKGQQN----------FAVSMLNVIRQSTPNENV 60
            ||||..|:   |||..           |:..::|:::          |...:|..:..::|..|:
Mouse    11 LAGLLTVK---GLLQDRDAPDMYDSPVRVQEWRGKKDARQLARHNMEFGFKLLQRLASNSPQGNI 72

  Fly    61 FFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV----VRSA--YILEKMNRKERQSKM 119
            |.||.|...|..:...|:...|.:|:.:..:.     ||:    |.:|  |:|.|:|::...:||
Mouse    73 FLSPLSISTAFSMLSLGAQNSTLEEIREGFNF-----KEMSNWDVHAAFHYLLHKLNQETEDTKM 132

  Fly   120 PLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFK----SQTEESRKQINDWIAKQTHDQIRNM 180
            .|    .:.:|....|...:...| ||:.|...|..    ...|.::|.||.:|:::||.:|:||
Mouse   133 NL----GNALFMDQKLRPQQRFLN-LAKNVYDADMVLTNFQDLENTQKDINRYISQKTHSRIKNM 192

  Fly   181 LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQL 245
            :.:  |.|.|.::|.|..|.:|:|..:|..::|....|:........|.||.|:|.:.:..|.||
Mouse   193 VKS--IDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGLYDMAYDSQL 255

  Fly   246 RAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPR 310
            ...:|::|||                .:|:...:||  ::..|:.:...|.||...........|
Mouse   256 SCTILEIPYR----------------GNITATFVLP--DNGKLKLLEQGLQADIFAKWKSLLSKR 302

  Fly   311 EIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT----SETISIGDSKHVAKIKVDEE 371
            .::|.:||........:..:|:::|:||:|:|:    .|||    ..::.:|::.|.|::|:||:
Mouse   303 VVDVWVPKLRISSTYNMKKVLSRLGISKIFEEN----GDLTRISSHRSLKVGEAVHKAELKMDEK 363

  Fly   372 GSTAAAATVLFTYRSARPVE-PAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            |...||.:...|.    |:| |...:.:.|||.:||:....|::|.....||
Mouse   364 GMEGAAGSGAQTL----PMETPRHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 104/404 (26%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 103/394 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.