DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpini2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_080736.2 Gene:Serpini2 / 67931 MGIID:1915181 Length:405 Species:Mus musculus


Alignment Length:408 Identity:117/408 - (28%)
Similarity:192/408 - (47%) Gaps:54/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWA 95
            ||::      .:|||.:...|..|..| |:.|||..|...|.:...|:.|..::::.|.|.:...
Mouse    23 DQKI------ADFAVDLYKAISLSHKN-NIIFSPLGTTMLLGMVQLGAKGKAQQQILKTLRMRGT 80

  Fly    96 DSKE---VVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQ----ID 153
            .:.|   |::|  :...:::|    |....|:.|..::......|.|...:...|..|.    :|
Mouse    81 PAGEEFSVLKS--LFSAISKK----KQEFTFNLASALYLQEGFIVKETYLHSNKEFFQSATKLVD 139

  Fly   154 FKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPF 218
            | ...:.|.:.|:.|:..:|..:|:||.|.:|..|.|||||.||.|.||.|..:|:.|.|....|
Mouse   140 F-LDAKTSAQAISTWVESKTDGKIKNMFSEEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDF 203

  Fly   219 YTSPSNYSLVSMMQ-----QKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVL 278
            .....:...|.||:     |.|.|   ....:...||:|||:.               .:.|:|:
Mouse   204 TKKDGSTVKVPMMKALLRAQYGYF---SQSSMTCQVLELPYKA---------------DEFSLVI 250

  Fly   279 ILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDES 343
            |||. ...|:|:|.:::.|..:.....:....|:|||||:|:.||:|:|...|..:.|:::|...
Mouse   251 ILPT-EDTSIEEVENQVTAPHVRRWFSELHEEEVEVSLPRFKIEQKLDLKEALYSLNVTEIFSGG 314

  Fly   344 VATFDDLTSETIS--IGDSKHVAKI--KVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFV 404
            .    ||:..|.|  :..|:.:.|:  :::|:||.|||:|.: ...:...:...:|..||||||:
Mouse   315 C----DLSGITDSSEVYVSRVMQKVFFEINEDGSEAAASTGI-NIPAIMSLTQTQFLANHPFLFI 374

  Fly   405 IYDRTSRSILFTGIYRDP 422
            :....:.||||.|...||
Mouse   375 LKHIRTESILFMGKVTDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 113/395 (29%)
Serpini2NP_080736.2 neuroserpin 23..405 CDD:239003 117/408 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.