DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina5

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:384 Identity:102/384 - (26%)
Similarity:188/384 - (48%) Gaps:34/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE-VVRSA 104
            ::||..:...:....|.:||||||.|...:|.:...||...|:.::.:.|.|.....:| ::...
  Rat    81 RDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQEDMLHKG 145

  Fly   105 YILEKMNRKERQSKMPLEFSSADRIFFANDLHVTE----CARNRLAEEVQQIDFKSQTEESRKQI 165
            :  :::.::..|....|:.|....:|....:|:.:    ..:.....::...:| ...|.::|||
  Rat   146 F--QQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNF-GNPESAKKQI 207

  Fly   166 NDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSM 230
            ||::||:|:.:|.:::.  ::.....:|:.|..:.|.:|.:.|.:..|..|.::.:|.....|.|
  Rat   208 NDYVAKKTNGKIVDLIK--DLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQVPM 270

  Fly   231 MQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRL 295
            |.::..:...:|:.:...|:.:||:                .:...:.|||  :...::.|...|
  Rat   271 MNREDIYSYILDQNISCTVVGIPYQ----------------GNTFALFILP--SEGKMKRVEDGL 317

  Fly   296 NADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET-ISIGD 359
            :..:|.:.||....|::::.||||..|...:|..||.|:|:..:| .:.|....||..| |.:.:
  Rat   318 DERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIF-TTHADLSGLTDHTNIKLSE 381

  Fly   360 SKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTG 417
            ..|.:.::|||.|:||||:| :|||.||||| ...|.|...|||.||.|.|  ::.|.|
  Rat   382 MVHKSMVEVDESGTTAAASTGILFTLRSARP-SSLKVEFTRPFLVVIMDGT--NLYFIG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 102/384 (27%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 102/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.