DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinb14

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_002665111.3 Gene:serpinb14 / 569051 ZFINID:ZDB-GENE-050506-148 Length:437 Species:Danio rerio


Alignment Length:464 Identity:122/464 - (26%)
Similarity:203/464 - (43%) Gaps:105/464 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL--------- 90
            :|......|::::...|.....:.|||:||.|...||.:...|:.|:|..::.|||         
Zfish     3 SLSAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNLPKSA 67

  Fly    91 ------HLDWADSKEVVRSAYILEK----MNRKERQSKMPLEFSSADRI--------------FF 131
                  |.......:..:|. :.::    |.::.::..:|.|......:              .|
Zfish    68 GATPEAHQSMMQQAQKPKSG-VKDQHGQAMMQQTQKIDIPAELKKGSAVPGQKAEEQIHSNFNKF 131

  Fly   132 ANDL------HVTECARNRLAEE--------------------VQQIDFKSQTEESRKQINDWIA 170
            .::|      :|...| |||..|                    ::::|||:::|.:|..||.|:.
Zfish   132 MSELNKPGAPYVLSLA-NRLYGEQTYQFVEKFLSDAKRYYEAGLEKVDFKNKSEAARVNINTWVE 195

  Fly   171 KQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKG 235
            |.|.::|:::|.:..|...|||||.||.|.||.|..:|..|.|....|..:.:....|.||.||.
Zfish   196 KNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWERKFPKEATNDGQFKLNKNQTKPVKMMYQKA 260

  Fly   236 TFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL 300
            .|.|....::.:.||:|||               ...::||::|||    :.:||..:.|     
Zfish   261 HFPLASIPEMNSQVLELPY---------------VGKNLSMLIILP----DQIEDATTGL----- 301

  Fly   301 DDSLKQAM---------------PREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDL 350
             :.|::|:               .:|::||||||:.||..::..:|..||:..:||........:
Zfish   302 -EKLEKALTYEKLMEWTKPEVMRQQEVQVSLPKFKMEQTYDMKSLLVSMGMEDVFDPQKVNLTGM 365

  Fly   351 TSET-ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSI 413
            :|.. :.:....|.|.::|:|||:.||||| .:...|..|  .|..|..:|||||.|....::||
Zfish   366 SSSNDLVLSKVIHKAFVEVNEEGTEAAAATGAIMMLRCIR--LPQSFNADHPFLFFIRHNPTKSI 428

  Fly   414 LFTGIYRDP 422
            ||.|.:..|
Zfish   429 LFYGRFCSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 120/455 (26%)
serpinb14XP_002665111.3 SERPIN 4..437 CDD:294093 121/461 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.