DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinf2b

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001073479.1 Gene:serpinf2b / 563663 ZFINID:ZDB-GENE-061215-114 Length:479 Species:Danio rerio


Alignment Length:401 Identity:106/401 - (26%)
Similarity:181/401 - (45%) Gaps:72/401 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRS 103
            |.....:..|..::.|....||.|||.|...||.....|::.|||:.|...||   ||:.....:
Zfish   107 GIMKLGLLFLENLKPSPDQPNVIFSPLSLSVALSQLALGATNDTEELLLHHLH---ADALPCYHT 168

  Fly   104 AYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQI-DFKSQTEESRKQIND 167
            |  |..:.|..|:..||:    |.||:......    |::...|:.|:: |.:..|......:|:
Zfish   169 A--LSSLLRNFRKRSMPI----ASRIYLKTGFK----AKSDFMEDSQKLYDSEPATLTDVNDVNE 223

  Fly   168 WIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQ 232
            |:.|.|:..|...||:  :.|...::|.||.:.||:||::|.       |.:||..|:.:.... 
Zfish   224 WVKKVTNGHISEFLSS--LPPSAVMMLINAMHYKGEWLTRFD-------PHFTSTENFYIDENQ- 278

  Fly   233 QKGTFLLNVD--------------EQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPF 283
                 ::|||              .:|.|.|.:.|::                .|.|:::::|..
Zfish   279 -----IVNVDMMLGPKYPLSVFTHHELDAQVARFPFK----------------GDRSLLVVMPTS 322

  Fly   284 NSNSLEDVLSRLNADSLDDSLKQAMPRE--IEVSLPKFEFEQRLELNPILAKMGVSKMFDESVAT 346
            ...::..:.::||...|...|    |||  ::|.||||:.:...:|...:..||:.|:|  |...
Zfish   323 GHVNVSAIAAKLNISDLYSRL----PRERNMQVKLPKFKLDFNQDLQEAMTSMGLGKLF--SHPK 381

  Fly   347 FDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSR 411
            .|.:|...:.:...:|::.::::|||:.|.|||.:...||    .|: |..|.||.|.:.|..|:
Zfish   382 LDRITEGPLFVSSVQHMSSVEINEEGAEAVAATSVVISRS----NPS-FTVNQPFFFALMDDLSQ 441

  Fly   412 SILFTGIYRDP 422
            :.||.|:..:|
Zfish   442 TPLFLGVISNP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 105/396 (27%)
serpinf2bNP_001073479.1 SERPIN 106..449 CDD:294093 105/396 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.