DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpind1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001015716.1 Gene:serpind1 / 548433 XenbaseID:XB-GENE-6085731 Length:484 Species:Xenopus tropicalis


Alignment Length:413 Identity:107/413 - (25%)
Similarity:184/413 - (44%) Gaps:63/413 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRLNLYKGQQNFAVSMLNVIRQST-PNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL----H 91
            |||::...  ||..::...|:.:| .::|:..:|.....|:.....|:.|....::...|    .
 Frog   110 QRLSIINA--NFGFNLYRAIKNNTDASDNILLAPVGISTAMATISLGTKGQALDQVLFTLGFKNF 172

  Fly    92 LDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAE----EVQQI 152
            ::.:...|::....:..|:..:..:........|.:.|:...|..:.|..:|.|..    |.|.:
 Frog   173 INASSKYEILTLHNVFRKLTHRLFRRNFGYTLRSVNDIYVKKDFVIREPFKNNLKNYYFAEAQMV 237

  Fly   153 DFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMP 217
            ||.|  ::...:.|..|.:.|...|:..|:  .:.|...::|.|..|.||.|.::|..|.|..|.
 Frog   238 DFGS--KDFLTKANKRIQQLTKGLIKEALT--NVDPALLMLLVNCIYFKGTWENKFPVEYTQNMN 298

  Fly   218 FYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPP 282
            |..:......|.||:.||.||:..|.:|...||||||                ..:|||:::|| 
 Frog   299 FRLNEKELVKVPMMKTKGNFLVAADPELDCAVLQLPY----------------VGNISMLIVLP- 346

  Fly   283 FNSNSLEDVLSRLNADSLDDSLKQAMPREI------------EVSLPKFEFEQRLELNPILAKMG 335
                      .:|:...|.:  ||..|:.:            ||.||:|:.|:...|..:|:.||
 Frog   347 ----------HKLSGMKLLE--KQISPQVVERWQNIMTNRTREVFLPRFKLEKSYNLQEVLSNMG 399

  Fly   336 VSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVL-FTYRSARPVEPAKFECNH 399
            |:.:|..  ..|..::.:.::||..:|...|.|:|||:.|||.||: |...|.:    |:|..:.
 Frog   400 VTDLFTH--GDFSGVSDKNMNIGLFQHQGTITVNEEGTEAAAVTVVGFMPLSTQ----ARFVADR 458

  Fly   400 PFLFVIYDRTSRSILFTGIYRDP 422
            ||||:||:..:..::|.|...:|
 Frog   459 PFLFLIYEHRTNCLIFMGRVANP 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 103/401 (26%)
serpind1NP_001015716.1 serpinD1_HCF2 38..484 CDD:381004 107/413 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.