DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINI2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001012303.2 Gene:SERPINI2 / 5276 HGNCID:8945 Length:405 Species:Homo sapiens


Alignment Length:425 Identity:106/425 - (24%)
Similarity:189/425 - (44%) Gaps:74/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LNLYKGQQ----------NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAK 88
            |.|:.|.|          .|||.:...:..| ..:|:.|||......|.:...|:.|..::::.:
Human    10 LLLFFGSQASRCSAQKNTEFAVDLYQEVSLS-HKDNIIFSPLGITLVLEMVQLGAKGKAQQQIRQ 73

  Fly    89 VLHLDWADSKEVVRSA----YILEKMNRKERQSKMPLEFSSADRIFFANDLHVTE----CARNRL 145
            .|       |:...||    ::|:.......:.|....|:.|:.::......|.|    ..:...
Human    74 TL-------KQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFF 131

  Fly   146 AEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKT 210
            ...::.:||: ..:...:.|:.|:.::|..:|::|.|.:|..|.|||||.||.|.||.|..:|:.
Human   132 QSAIKLVDFQ-DAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRK 195

  Fly   211 EKTVPMPFYTSPSNYSLVSMMQQKGTFLLNV------DEQLRAHVLQLPYRTVFESQEKEDSSPD 269
            |.|..:.|  :..|.|.|.:...|.  ||..      :..|...||:|.|:              
Human   196 EDTQLINF--TKKNGSTVKIPMMKA--LLRTKYGYFSESSLNYQVLELSYK-------------- 242

  Fly   270 ENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKM 334
             ..:.|:::|||. ....:|:|...:.|..:...|.:....|:|:|||:|:.||:::...:|..:
Human   243 -GDEFSLIIILPA-EGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFKVEQKVDFKDVLYSL 305

  Fly   335 GVSKMFDESVATFDDLTSETISIGDSKHVAKI------KVDEEGSTAAAATVLFTYRSARPV--- 390
            .::::|....    ||:..|.|  ...:|:::      :::|:||.||.:|.:..     ||   
Human   306 NITEIFSGGC----DLSGITDS--SEVYVSQVTQKVFFEINEDGSEAATSTGIHI-----PVIMS 359

  Fly   391 -EPAKFECNHPFLFVIYDRTSRSILFTGIYRDPKT 424
             ..::|..||||||::....:.||||.|...:|.|
Human   360 LAQSQFIANHPFLFIMKHNPTESILFMGRVTNPDT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 102/413 (25%)
SERPINI2NP_001012303.2 serpinI2_pancpin 23..392 CDD:381042 100/408 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.