DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINB13

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:418 Identity:128/418 - (30%)
Similarity:194/418 - (46%) Gaps:85/418 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD--------WADSKEVVRSAYILEK 109
            :.|.:.|:||||.....|:.:...|:.|.|..:|.:|.|.:        .|:.|||||.     |
Human    20 KKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRI-----K 79

  Fly   110 MNRKERQS---------KMPLEFSSADRIFFAND--LHVTECARNRLAEE--------------- 148
            ...||.::         |...|.|.     ..||  |::|    |||..|               
Human    80 AEGKEIENTEAVHQQFQKFLTEISK-----LTNDYELNIT----NRLFGEKTYLFLQKYLDYVEK 135

  Fly   149 -----VQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQF 208
                 ::.:||.:..:||||:||.|:..:|:::|:::.....|:..|:|||.|..|.||||..:|
Human   136 YYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREF 200

  Fly   209 KTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSD 273
            |.|.|....|:.:.|....|.||.|..:|.....|.|:|.:|.:||:               |:|
Human   201 KKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYK---------------NND 250

  Fly   274 ISMVLILPPFNSNSLEDVLSRLNADSLDD--SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGV 336
            :||.::||. :.:.||.::.:::.:.|.:  |......|::.:.||:||.|...:|..:||.||:
Human   251 LSMFVLLPN-DIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGM 314

  Fly   337 SKMFDESVATFDDLTSETISIGDSKHVAK------IKVDEEGSTAAAAT-VLFTYRSARPVEPAK 394
            ...|.|..|.:..::|     |...:..|      :.|.|||:.||||| :.||..||...|  .
Human   315 GDAFSEHKADYSGMSS-----GSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHE--N 372

  Fly   395 FECNHPFLFVIYDRTSRSILFTGIYRDP 422
            ..|||||||.|....|.||||.|.:..|
Human   373 VHCNHPFLFFIRHNESNSILFFGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 127/413 (31%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 127/416 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.