DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINB10

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_005015.1 Gene:SERPINB10 / 5273 HGNCID:8942 Length:397 Species:Homo sapiens


Alignment Length:420 Identity:112/420 - (26%)
Similarity:191/420 - (45%) Gaps:83/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYIL 107
            ||:.:...:.:|...:|:|||.:|...:|.:.|.|:.|.|..::|:||                 
Human    11 FALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVL----------------- 58

  Fly   108 EKMNR---------KERQSKMPLEFSSAD-----------RIFFANDLHVTECA----------- 141
             :.||         .|::.||....|:::           .|...||.::.:.|           
Human    59 -QFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAF 122

  Fly   142 RNRLAE--------EVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAA 198
            .|:..|        |.|.::|...:::.||.||.|:.:||..:|:|:|..|.:...||::|.||.
Human   123 HNKYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNAL 187

  Fly   199 YLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEK 263
            |.||.|..||..:.|...||..:.:....|.||..|....:...|:.:|..|||.|:        
Human   188 YFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYK-------- 244

  Fly   264 EDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPR--EIEVSLPKFEFEQRLE 326
                   :.|:|::::||. :.|.||.:...:..:.|::.....|..  |:::.||||:.|...:
Human   245 -------SRDLSLLILLPE-DINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYD 301

  Fly   327 LNPILAKMGVSKMFDESVATFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAAT---VLFTYRSA 387
            |...|:.||:|..|.:|.|.|..::| ..:.:.:..|.|.::::|:|:.|||.:   :....|  
Human   302 LKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSEIDIRIR-- 364

  Fly   388 RPVEPAKFECNHPFLFVIYDRTSRSILFTG 417
              |...:|..||||||.|....:.:|||.|
Human   365 --VPSIEFNANHPFLFFIRHNKTNTILFYG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 112/420 (27%)
SERPINB10NP_005015.1 PAI-2 4..397 CDD:239013 112/420 (27%)
Nuclear localization signal 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.