DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINB8

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:404 Identity:120/404 - (29%)
Similarity:203/404 - (50%) Gaps:48/404 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKE 99
            :|.:....||:|:..::.:...:.||||||.|...||.:.:.|:.|.|..::::.|.| :.|. :
Human     3 DLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCL-YKDG-D 65

  Fly   100 VVRS-AYILEKMNRKERQSKMPLEFSSADRIF------FANDLHVTECARNRLAEEVQQIDFKSQ 157
            :.|. ..:|.::||...|..:    .:|:|:|      |..|.  .|..:.....|::::.|...
Human    66 IHRGFQSLLSEVNRTGTQYLL----RTANRLFGEKTCDFLPDF--KEYCQKFYQAELEELSFAED 124

  Fly   158 TEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSP 222
            |||.||.||||:|::|..:|..:|.|..:.|.|:|||.||.|.||:|..||..:.|..|.|.|:.
Human   125 TEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNE 189

  Fly   223 SNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSN- 286
            .. ..|.||.::..|.:...:::...||:|||               ...::|||::||..|:: 
Human   190 EK-KTVQMMFKEAKFKMGYADEVHTQVLELPY---------------VEEELSMVILLPDDNTDL 238

  Fly   287 -------SLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESV 344
                   :.|...:..|::.|..|       :::|.||:.:.|:..:|.|.|.::|:...|||:.
Human   239 AVVEKALTYEKFKAWTNSEKLTKS-------KVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAK 296

  Fly   345 ATFDDLTSE-TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDR 408
            |.|..:::| .:.:....|...::|:|||:.|||||.:........:|| :|..:|||||.|...
Human   297 ADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEP-RFCADHPFLFFIRHH 360

  Fly   409 TSRSILFTGIYRDP 422
            .:..|||.|.:..|
Human   361 KTNCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 118/395 (30%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 119/401 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.