DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINE1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:384 Identity:104/384 - (27%)
Similarity:169/384 - (44%) Gaps:55/384 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKEL--AKVLHLDWADSKEVVRSA 104
            :|.|.:...:.|::.:.||.||||.....|.:....:.|:|::::  |....:|.......:|..
Human    37 DFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHL 101

  Fly   105 Y--ILEKMNRKERQSKMPLEFSSADRIFFANDL--------HVTECARNRLAEEVQQIDFKSQTE 159
            |  ::...|:.        |.|:.|.||...||        |.....|:    .|:|:|| |:.|
Human   102 YKELMGPWNKD--------EISTTDAIFVQRDLKLVQGFMPHFFRLFRS----TVKQVDF-SEVE 153

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
            .:|..||||:...|...|.|:|....:...|||||.||.|..|||.:.|....|....|:.|..:
Human   154 RARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGS 218

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAH---VLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNS- 285
            ...|.||.|...|..........|   :|:|||                :.|...:.|..|:.. 
Human   219 TVSVPMMAQTNKFNYTEFTTPDGHYYDILELPY----------------HGDTLSMFIAAPYEKE 267

  Fly   286 ---NSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATF 347
               ::|.::||.........::.: :||.:  .||||..|..::|...|..:|::.||.:..|.|
Human   268 VPLSALTNILSAQLISHWKGNMTR-LPRLL--VLPKFSLETEVDLRKPLENLGMTDMFRQFQADF 329

  Fly   348 DDLT-SETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVI 405
            ..|: .|.:.:..:....||:|:|.|:.|:::|.:..  ||| :.|.:...:.|||||:
Human   330 TSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIV--SAR-MAPEEIIMDRPFLFVV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 104/384 (27%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 104/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.