DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Spn38F

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster


Alignment Length:403 Identity:125/403 - (31%)
Similarity:196/403 - (48%) Gaps:70/403 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAY-- 105
            |...:..::.:...::|:..||.|...||.|||.|:.|.|.:|:..||.|  .|.|:.|.:.:  
  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL--PDDKKEVAAKFKD 79

  Fly   106 ILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQI---DFKSQTEE------- 160
            :|.|:..:|..:.:.|    |:||:..|        :.:|..|..|:   .||::.|.       
  Fly    80 LLSKLEGRESVAILSL----ANRIYVNN--------KFKLVPEYNQMVKDSFKAEAEAISANNPK 132

  Fly   161 -SRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
             :...:|.|:..||..:||:::...::. ...||:.||.|.||||..:|.||:| ...|:.|...
  Fly   133 ITASIVNKWVDTQTSGKIRDLVMPSDVA-NLVLVILNAIYFKGQWQKKFNTEQT-KSDFHISDQK 195

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289
            ...|.||.....|.::.|.:|.|:|::||||               ||::|||:.||.       
  Fly   196 SVPVQMMSLVRPFGVSYDRELGANVIELPYR---------------NSNLSMVIFLPD------- 238

  Fly   290 DVLSRLNADSLDDSLKQAM---PREIEVS----LPKFEFEQRLELNPILAKMGVSKMFDESVATF 347
                  ..|.|.:..|:.:   |:.|.::    ||||:.|....|..:|..||:...|..| |.|
  Fly   239 ------KVDGLPELEKKMVGFTPKLININVHLRLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADF 296

  Fly   348 DDLTSET-ISIGDSKHVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTS 410
            :||.:.: ..:|...|.|.::|:||||.||||| |:|.|:|.|. .|..|..||||.:||  |.:
  Fly   297 NDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRS-PPMDFNVNHPFAYVI--RDA 358

  Fly   411 RSILFTGIYRDPK 423
            .:|.|.|.:.:|:
  Fly   359 ENIYFQGHFVNPE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 124/397 (31%)
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 124/400 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.