DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinb6

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001007932.1 Gene:serpinb6 / 493311 XenbaseID:XB-GENE-1001870 Length:379 Species:Xenopus tropicalis


Alignment Length:403 Identity:123/403 - (30%)
Similarity:198/403 - (49%) Gaps:57/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADS---------K 98
            ||::.|..|.:|....|:|.||.|...||.:...|:.|:|..::::||.||..|.         .
 Frog    11 FAINFLKKINESNKTGNIFVSPLSISSALSMVLLGAKGNTATQMSQVLKLDKVDDAHCNFQSLIS 75

  Fly    99 EVVRSA--YILEKMNR--KERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTE 159
            |:.:|.  |:|...||  .|:......||..:.:..:..||              :.:||..:.|
 Frog    76 EINKSGTNYLLRTANRLYGEKSYTFLEEFLGSTQKHYHADL--------------KAVDFSRKAE 126

  Fly   160 ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSN 224
            |||.:||:|:|::|..:|:::||:..:...|||||.||.|.||.|.::|..:.|...||..:.:.
 Frog   127 ESRGEINEWVAQKTEGKIKDLLSSGSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNE 191

  Fly   225 YSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLE 289
            ...|.||.:|..|.:....:|...|:::||               .::::||:::||    :.:.
 Frog   192 TKPVQMMFKKAKFPMTYIGELFTKVVEIPY---------------VDNELSMIILLP----DDIN 237

  Fly   290 DVLSRLNA----DSLDDSLKQAMPR-----EIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVA 345
            |..:.|.|    .:.:..||...|.     |:|:|||||:.|...:|...|:.||:|..||:..|
 Frog   238 DGTTGLEALEKELTYEKFLKWTNPEMMDITEMELSLPKFKLEDDYDLESFLSTMGMSDAFDQRRA 302

  Fly   346 TFDDLTS-ETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRT 409
            .|..::| ..:.:....|.:.:.|:|||:.|||||..........:.| :..|:|||||.|..|.
 Frog   303 DFSGMSSANDLFLSKVLHKSFVDVNEEGTEAAAATAAIMMLRCAMIIP-RIVCDHPFLFFILHRP 366

  Fly   410 SRSILFTGIYRDP 422
            |:||||.|.:..|
 Frog   367 SQSILFCGRFALP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 122/398 (31%)
serpinb6NP_001007932.1 PAI-2 4..379 CDD:239013 122/401 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.