DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and nec

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:399 Identity:104/399 - (26%)
Similarity:188/399 - (47%) Gaps:34/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            ::.....|:..:...|.:|...:||.|||:|.:..|.|.|..|.|.|.:||.|....    ||..
  Fly   103 VFSYMDRFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEF----SKNA 163

  Fly   101 VRSAYILEKMNRKERQSKMPLEFSSADRIFFANDL-----HVTECARNRLAEEVQQIDFKSQTEE 160
            :..|...|.:.:.::..: ..:.:.|.::::..:|     ...|.|:...:...:.:|.::..:.
  Fly   164 MAVAQDFESVIKYKKHLE-GADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDT 227

  Fly   161 SRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNY 225
            :.| ||.|:...|.::||::::..::.|:|:.:|.||.|.:|:|..:|.|..|.|..|..:....
  Fly   228 AAK-INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRI 291

  Fly   226 SLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLED 290
            |.|:||.....:.|....:|.|..|:|.|:         ||:       :.:|||.|..:..|..
  Fly   292 SKVAMMFNDDVYGLAELPELGATALELAYK---------DSA-------TSMLILLPNETTGLGK 340

  Fly   291 VLSRLNADSLD-DSLKQAMPRE-IEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSE 353
            :|.:|:....| :.:...:.|: :.|.||||:||...::...|..:||.:||..: :....|..:
  Fly   341 MLQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN-SQVTKLMDQ 404

  Fly   354 TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTG- 417
            .:.:......|.|.|.|.|:.|:||:.......:.|.:|.:|..|.||:|.:  ||..|:||.| 
  Fly   405 PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAV--RTPASVLFIGH 467

  Fly   418 -IYRDPKTI 425
             .|..|.::
  Fly   468 VEYPTPMSV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 102/388 (26%)
necNP_524851.1 SERPIN 108..468 CDD:238101 102/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.