DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Spn27A

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:443 Identity:117/443 - (26%)
Similarity:195/443 - (44%) Gaps:82/443 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLCGVEPDAGLLDQRLNLY-----KGQQNFAVSML-NVIRQSTPNENVFFSPYST--YHALLLAY 75
            |...|...||:.|. ::.:     .....|:..:| .|::..|.::||..||:|.  ..|||...
  Fly    48 GAASVPSGAGIYDD-IDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEA 111

  Fly    76 FGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTEC 140
            .|:...|:.||        |:::..:||...:.:..||...|     |..      .|.||.|..
  Fly   112 AGAGTQTQVEL--------ANTQTDIRSQNNVREFYRKTLNS-----FKK------ENQLHETLS 157

  Fly   141 ARNRL--------------------AEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADE 185
            .|.:|                    ..||:.:|| :..|.:...||.|.|..|..:::.:::.|.
  Fly   158 VRTKLFTDSFIETQQKFTATLKHFYDSEVEALDF-TNPEAAADAINAWAANITQGRLQQLVAPDN 221

  Fly   186 ITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVL 250
            :.... ::|.|..|..|.|..||.|  |....|:.|..:.|....|:|...|.....|:|:|.:|
  Fly   222 VRSSV-MLLTNLIYFNGLWRRQFAT--TFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQIL 283

  Fly   251 QLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPR-EIEV 314
            :|||:             .:||    :.:|.|:..|.:.|::..|..|.| .|.:.||.. :::|
  Fly   284 RLPYK-------------GKNS----LFVLLPYALNGIHDLVKNLENDEL-KSAQWAMEEVKVKV 330

  Fly   315 SLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-----SETISIGDSKHVAKIKVDEEGST 374
            :||||.|:.:..|...|..:||.::|::| |:...||     :..:.:.:....|.|.|:|:|:.
  Fly   331 TLPKFHFDYQQNLKETLRSLGVREIFEDS-ASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTE 394

  Fly   375 AAAATVL---FTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPKT 424
            |.||||:   ..:..:..:|  :|..|.||:|.|.:.::.:|||.|....|.|
  Fly   395 AYAATVVEIENKFGGSTAIE--EFNVNRPFVFFIEEESTGNILFAGKVHSPTT 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 110/411 (27%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 110/411 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.