DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpinf1

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:448 Identity:101/448 - (22%)
Similarity:182/448 - (40%) Gaps:71/448 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILSISLMAVLPA--IALAGLCGVEPDAGLLD----QRLNLYKGQQNFAVSMLNVIRQSTPNENVF 61
            :|.:.|.::|..  ..||.....|.:...:|    .|..|.....:|..::...:.......:||
Zfish     5 VLLVGLWSLLSLSHAQLADTTDAEGEEEAVDLFTTPRTKLAAATSDFGYNLFRQLASRDTKASVF 69

  Fly    62 FSPYSTYHALLLAYFGSSGDTEKELAKVLH---LDWADSKEVVRSAYILEKMNRKERQSKMPLEF 123
            .||.|...|......|:|...||::.:.|.   |..:...:.:|.  :|..:....:      .|
Zfish    70 LSPMSISAAFTQLSMGASERAEKQIYRALRYHTLQDSQLHDTLRD--LLSSLRASAK------GF 126

  Fly   124 SSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESR---------KQINDWIAKQTHDQIRN 179
            .||:||..|..|      |.|| |.:..:: |...|..:         |.:|||..:||..::  
Zfish   127 KSAERILLARKL------RLRL-EYLNSVE-KQYGERPQILAGGARDLKTVNDWFKQQTGGKV-- 181

  Fly   180 MLSADEITP-----RTRLVLANAAYLKGQWLSQF-KTEKTVPMPFYTSPSNYSLVSMMQQKG-TF 237
                |::.|     .|.|:...:||.||:|:::| |..|.  ..|.......:::.||:|:. ..
Zfish   182 ----DQVVPSPLPRNTALLPVGSAYFKGKWITRFGKPNKM--ETFRRDGQAPAVIPMMEQENYPV 240

  Fly   238 LLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDD 302
            .:.:|..|...:.|:|         .||.       :||...||...:.:|..:...|.|:.:.|
Zfish   241 KMGIDSDLGCTIAQVP---------MEDG-------VSMYFFLPDEVTQNLTLIEEALTAEFVQD 289

  Fly   303 SLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIK 367
            ........::.::||..:...:..|.|.|:.:|:|:...|:..|  .:||:.:.:....|...::
Zfish   290 LSNSLHTVKVLLTLPVIKLSYKTNLLPSLSDLGLSEWLAETDLT--KITSQPVKLNAVHHKVVLE 352

  Fly   368 VDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDPKTI 425
            ...||:..|:.|...|.:|.    ...:..:.||||::.|..|.::||.|...:|..:
Zfish   353 TAPEGAEYASTTPSATGQSL----GLSYRVDRPFLFLVRDEPSGALLFIGKVLNPSDL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 91/398 (23%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 94/418 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.