DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Spn100A

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:361 Identity:92/361 - (25%)
Similarity:157/361 - (43%) Gaps:67/361 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EKELAKVLHLDWADSKEVVRSAYILEKM-NRKERQSKMPLEFSSADRIFFANDLHVTECARNRLA 146
            |::|||::......:.|..:....|:|: |..:..:|     ..||.|..|.:.|:...:|...|
  Fly   312 EEKLAKIMAAPALTAGEPEKVRLPLQKLENAVKTAAK-----DGADEIMLALESHLPSVSRVNGA 371

  Fly   147 EEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPR-----TRLVLANAAYLKGQWLS 206
            ..:.|                      .|.|.:.|||:.||.|     ::::|.|..|.:|.|.:
  Fly   372 RSLFQ----------------------QDDITSALSANSITGRSAGSKSKMLLFNGLYYRGSWAN 414

  Fly   207 QFKTEKTVPMPFYTSPSNYSL-VSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDE 270
            .|...:.....|:...:..:: ..||..:|.|.:....|::|.||.|||               |
  Fly   415 PFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPY---------------E 464

  Fly   271 NSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMG 335
            .|..::.::||. .:..|.||:|:|.......:.||...:|:.:|:|||:.|:......:|.:||
  Fly   465 TSRYALCIVLPD-ETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMG 528

  Fly   336 VSKMFDESVATFDDLTSE-TISIGDSKHVAKIKVDEEGSTA---AAATVLFTYRSAR----PV-- 390
            :.|:|..:.|....|:.: .:.:.:......::|||.||:|   :|||:.....|..    ||  
  Fly   529 LKKVFSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVESTVLPVPE 593

  Fly   391 -EP-----AKFECNHPFLFVIYDRTSRSILFTG-IY 419
             ||     .:||.|.||.:.|.|...:.:|.:| ||
  Fly   594 PEPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIY 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 90/359 (25%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.