DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:402 Identity:122/402 - (30%)
Similarity:209/402 - (51%) Gaps:41/402 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD-----W 94
            :|.:....|.:.:..|:.:.: ::|||||..|.:.:|.|...|::|.|..::::||.||     .
Mouse    55 SLLEANATFTLKLFRVLGEDS-SKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGG 118

  Fly    95 ADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAE----EVQQIDFK 155
            ||.::..:|  :|.::|:.:....:    ..|::||..|:..:.|..:....:    |::::|||
Mouse   119 ADVQQGFQS--LLTEVNKTDTGHML----RRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFK 177

  Fly   156 SQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYT 220
            ...|:.|:.||.|:||:|.|.||.:||...:...|||:|.||.|.||:|..||..|.|..|||..
Mouse   178 GTPEQCRQHINAWVAKKTKDVIRELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKV 242

  Fly   221 SPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSS----PDENSDISMVLILP 281
            |.:....|.||.:|.||.....|::...::.|||      .:||.|.    |||..::|||    
Mouse   243 SKNEKKTVQMMSKKSTFKTYYAEEISTTIVFLPY------TDKELSMIIMLPDEQVELSMV---- 297

  Fly   282 PFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVAT 346
             .|..|.:.::.......:::       .|::|.||:|:.|...::..:|.|:|::..|:||.|.
Mouse   298 -ENQISYKKLIQWTRLVKMEE-------EEVQVFLPRFKLEATYDMKDVLCKLGMTDAFEESRAD 354

  Fly   347 FDDLTSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTS 410
            |..::|:. :.:.:..|.:.::|:|||:.||.||.:.|..|  |:.......:.||||:|....|
Mouse   355 FSGISSKKGLFLSNVVHKSFVEVNEEGTEAAVATEIVTVGS--PLTQRCLIADRPFLFLIQGDKS 417

  Fly   411 RSILFTGIYRDP 422
            :.|||.|.:..|
Mouse   418 KEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 120/393 (31%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 121/400 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.