DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb3d

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:400 Identity:115/400 - (28%)
Similarity:201/400 - (50%) Gaps:43/400 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYIL 107
            |.:.:...:|:|  :.|:|:||.|....|.:...|:..:||:::.||||.:....|...:||...
Mouse    11 FTLELYRQLRES--DNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAESH 73

  Fly   108 EKMNRKERQSKMPL----EFSSA------DRIFFANDLHVTEC----ARNRLAEEVQQIDFKSQT 158
            ::.| ..:|.:|.:    :|::|      :.|:.|.|....:.    .|......|:.:||....
Mouse    74 DEEN-VHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHAA 137

  Fly   159 EESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPS 223
            |||:|:||.|:|:||:.:|:::..:..:...|.|||.||.|.||||..:|..:.|....|:.:.:
Mouse   138 EESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLNKN 202

  Fly   224 NYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSL 288
            ....|.||:|:..|.....|.::|.::::||:               ..::||.::| |...:.|
Mouse   203 TSKPVQMMKQRNKFNFIFLENVQAKIVEIPYK---------------GKELSMFVLL-PVEIDGL 251

  Fly   289 EDVLSRLNADSL-----DDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFD 348
            :....:|.||.|     .:::...   |:.:|||:|:.|::.:|...|..||:...||...|.|.
Mouse   252 KKFEEQLTADKLLQWTRAENMHMT---ELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFS 313

  Fly   349 DLT-SETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRS 412
            .:: |:.:.:....|.:.::|:|||:.||.|..:.: ||....:|..|.||||||||:....:.|
Mouse   314 GMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMSVES-RSLSVPKPNDFSCNHPFLFVMKQNKTNS 377

  Fly   413 ILFTGIYRDP 422
            |||.|....|
Mouse   378 ILFFGRVSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 114/395 (29%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 114/398 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.