DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and serpine2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:387 Identity:116/387 - (29%)
Similarity:179/387 - (46%) Gaps:47/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKER 115
            :.|....|||..||:.....|.:...|:.|||.::|...|       |......|   ||.||..
Zfish    41 VLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQLLNGL-------KYKKNGPY---KMLRKLH 95

  Fly   116 QSKMPLEFSSADRIFFANDLHVTE----------CARNRLAEEVQQIDFKSQTEESRKQINDWIA 170
            :|....  |:||.:..||.|...|          ..|.....|...:|: |..|.:.:.||||:.
Zfish    96 KSLTTK--SNADIVTIANALFPNEGFSMKEDFLSANRENFLCESHSVDY-SDPEAAAQSINDWVK 157

  Fly   171 KQTHDQIRNMLSADEI-TPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQK 234
            ..|..||.::::||.. |..||||..|:.:.||.|.|:|:.:.|.|..|.....|...|.||.|.
Zfish   158 NSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYKVPMMSQL 222

  Fly   235 GTFLL---NVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLN 296
            ..|.:   :..:..:..|::|||               ..:.:||.:.||..:|..|..:|..::
Zfish   223 SVFNMGQASTPDGQKYIVIELPY---------------HGNSMSMFIALPTEDSTPLSSILPHIS 272

  Fly   297 ADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSK 361
            .:::....|...||.:.:.:|||..||.|:|...|..:|:..:||::.|.|..|:||:|.:..:.
Zfish   273 TNTIQSWTKLMNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSESIYVSKAL 337

  Fly   362 HVAKIKVDEEGSTAAAAT-VLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            ..|||:|:|:|:.|:|.| |:...||:    |.....:.||||:|...:|.:|||.|....|
Zfish   338 QKAKIEVNEDGTKASATTSVILHARSS----PPWVTVDRPFLFLIRHNSSGTILFAGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 115/382 (30%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 115/385 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.