DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and SERPINA2

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:454 Identity:97/454 - (21%)
Similarity:182/454 - (40%) Gaps:91/454 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IALAGLCGVEPDAGLLD------QRLNLYKGQQ----------------NFAVSMLNVIRQSTPN 57
            :.|||||.:.|.:.:.|      |:.:.....|                :.|..:...:...:..
Human    10 LLLAGLCCLVPSSLVEDPQEDAAQKTDTSHHDQGDWEDLACQKISYNVTDLAFDLYKELADLSQT 74

  Fly    58 ENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV-VRSAY--ILEKMNRKERQSKM 119
            .||..:|.|...|..:...|:..||..|:.:.|:::..::.|. :...:  :|:.::|.:.:   
Human    75 SNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIHECFQQVLQALSRPDTR--- 136

  Fly   120 PLEFSSADRIFFANDLHVT----ECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNM 180
             |:.::...:|....:.:.    |..:.....|...|:|: .|||:::|||:::.|:|..::.::
Human   137 -LQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFR-DTEEAKEQINNYVEKRTGRKVVDL 199

  Fly   181 LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQL 245
            :.  .:...|.|.|.:.....|:|..:||.|..:...|:........|.|:...|.|.::.|.:|
Human   200 VK--HLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRVPMINHLGRFDIHRDREL 262

  Fly   246 RAHVLQLPY---RTVFESQEKEDSSPDENSDISMVLILP-PFNSNSLEDVLSRLNADSLDDSLKQ 306
            .:.||...|   .|.|                   .||| |.....||:   :|....|::..:.
Human   263 SSWVLAQHYVGNATAF-------------------FILPDPKKMWQLEE---KLTYSHLENIQRA 305

  Fly   307 AMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSET-ISIGDSKHVAKIKVDE 370
            ...|.|.:..||.......:|..:|..:|::|:|... |....::.|. :.:..:.|||.:.:||
Human   306 FDIRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNE-ADLSGVSQEAPLKLSKAVHVAVLTIDE 369

  Fly   371 EGSTAAAA------------TVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            :|:.|..|            ||:|               |.|||.:|.|..:...||.|...:|
Human   370 KGTEATGAPHLEEKAWSKYQTVMF---------------NRPFLVIIKDDITNFPLFIGKVVNP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 88/419 (21%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 86/400 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.