DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb1c

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:437 Identity:120/437 - (27%)
Similarity:200/437 - (45%) Gaps:70/437 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MAVLPAIALAGLCG-VEPDA------GLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYS 66
            :.||....||.:.| |:|.:      |.|....||      ||:.:.:.:.:|.|..|..|||.|
Mouse     9 LQVLGVGGLADIVGNVDPPSVAAFTMGQLSSANNL------FALELFHTLNESNPTGNTIFSPVS 67

  Fly    67 TYHALLLAYFGSSGDTEKELAKVLHLDWAD---------SKEVVR--SAYILEKMNR---KERQS 117
            ...||.:.|.|:.|.|..:|:|.||.|.|:         :.||.:  :::.|:..||   ::..:
Mouse    68 ISSALAMVYLGARGSTAAQLSKTLHFDSAEDIHSQFQSLTAEVSKRGASHTLKLANRLYGEKTYN 132

  Fly   118 KMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLS 182
            .:|...:|..:.:.|               ::..:||:..:|::||:||.|:..||.::|:.:.:
Mouse   133 FLPEYLASIQKTYSA---------------DLALVDFQHASEDARKEINQWVKGQTEEKIQELFA 182

  Fly   183 ADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRA 247
            ...:...|:|||.||.|.||.|..:|....|...||..|......|.||..|..........|:.
Mouse   183 VGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTKTVKMMYLKNNLPFGYIPDLKC 247

  Fly   248 HVLQLPYRTVFESQEKEDSSPDENSDISMVLILP---PFNSNSLEDVLSRLNADSLDDSLKQAMP 309
            .||::||               :..::|||::||   ...:..||::..:|..:.|.: .:....
Mouse   248 KVLEMPY---------------QGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQE-CENLQN 296

  Fly   310 REIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT-SETISIGDSKHVAKIKVDEEGS 373
            .::.|.||||:.|:...||..|.::||..:|..|.|....:: |..:.|....|.:.::|:|||:
Mouse   297 IDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSYVEVNEEGT 361

  Fly   374 TAAAA---TVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTG 417
            ...||   ||:     ...:.|.:|..:|||||.|....:..:||.|
Mouse   362 ETDAAMPGTVV-----GCCLMPMEFTVDHPFLFFIRHNPTAHVLFLG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 109/400 (27%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 113/412 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.