DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina11

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_955018.2 Gene:Serpina11 / 380780 MGIID:2685741 Length:427 Species:Mus musculus


Alignment Length:409 Identity:98/409 - (23%)
Similarity:175/409 - (42%) Gaps:73/409 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL--HLDWADSKEVVRSA 104
            |||:.:...:.:.... |:.|||.|...:|.|...|:..||:.::.:.|  :|....:.:|.|..
Mouse    61 NFALRLYKQLAEEVAG-NILFSPVSLSSSLALLSLGAHADTQTQILESLGFNLTETPAADVHRGF 124

  Fly   105 YIL--------EKMNRK-------ERQSKMPLEF-SSADRIF--FANDLHVTECARNRLAEEVQQ 151
            ..|        .|:..|       :||.|....| .||..::  .|...:.||.|          
Mouse   125 QSLLHTLDLPSPKLELKLGHFLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAA---------- 179

  Fly   152 IDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPM 216
                    .:.:||||.:.|||:.|:...|  .|.:..|.:||.|..:.|.:....|...:|...
Mouse   180 --------ATGQQINDLVRKQTYGQVVGCL--PEFSHDTLMVLLNYIFFKAKCKHPFDRYQTRKQ 234

  Fly   217 PFYTSPSNYSL-VSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLIL 280
            ..::......| :.||:||.......|::....|||:.|                :....::|:|
Mouse   235 ESFSLDQRTPLRIPMMRQKEMHRFLYDQEASCTVLQIEY----------------SGTALLLLVL 283

  Fly   281 PPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVA 345
            |  :...::.|.:.|..::|....::.:|..:::.||:|.......|..||..:|:..:||... 
Mouse   284 P--DPGKMQQVEAALQPETLRRWGQRFLPSLLDLHLPRFSISATYNLEEILPLIGLGNLFDMEA- 345

  Fly   346 TFDDLT------SETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPA-KFECNHPFLF 403
               ||:      ::|:|  ...|.|.:.::|:|:.||||:.|.:...|..:..| :...|.|||.
Mouse   346 ---DLSGIMGQLNKTVS--RVSHKAIVDMNEKGTEAAAASGLLSQPPALNMTSAPQAHYNRPFLL 405

  Fly   404 VIYDRTSRSILFTGIYRDP 422
            ::::.|::|:||.|...:|
Mouse   406 LLWEVTTQSLLFLGKVVNP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 97/404 (24%)
Serpina11NP_955018.2 SERPIN 58..421 CDD:294093 97/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.