DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and AT1G62160

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:179 Identity:54/179 - (30%)
Similarity:80/179 - (44%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 VLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPRE-I 312
            ||:||||     |.::::    |.:.||...||. ....|:|:|.|:.  |....|....||| :
plant    72 VLRLPYR-----QGRDNT----NRNFSMYFYLPD-KKGELDDLLKRMT--STPGFLDSHTPRERV 124

  Fly   313 EVS---LPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGST 374
            ||.   :|||:.|...|.:.:.:...:...|.:.                    |.|::||||:.
plant   125 EVDEFRIPKFKIEFGFEASSVFSDFEIDVSFYQK--------------------ALIEIDEEGTE 169

  Fly   375 AAAATVLFTYRSARP-VEPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
            |||||.......... ||...|..:|||||:|.:..:.::||.|...||
plant   170 AAAATAFVDNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFAGQIFDP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 52/174 (30%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 52/177 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.