DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpina11

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:451 Identity:99/451 - (21%)
Similarity:178/451 - (39%) Gaps:117/451 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVL--HLDWADSKEVVRSA 104
            |||:.:...:.:..|. |:.|||.|....:.|...|:..||:.::.:.|  :|....:.::.|..
  Rat    56 NFALRLYKQLAEEIPG-NILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNLTETPAADIHRGF 119

  Fly   105 YIL--------EKMNRK-------ERQSKMPLEF-SSADRIF--FANDLHVTECARNRLAEEVQQ 151
            ..|        .|:..|       :||.|....| .||..::  .|...:.||.|          
  Rat   120 QSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAA---------- 174

  Fly   152 IDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQW---LSQFKTEKT 213
                    .:.:||||.:.|||:.|:...|  .|....|.:||.|..:.|.:|   ..:::|.| 
  Rat   175 --------ATGQQINDLVRKQTYGQVVGCL--PEFDRDTLMVLLNYIFFKAKWKHPFDRYQTRK- 228

  Fly   214 VPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVL 278
             ...|:........:.||:||.......|::....|||:.|                :....::|
  Rat   229 -QESFFVDQRLQLRIPMMRQKEMHRFLYDQEASCTVLQIEY----------------SGTALLLL 276

  Fly   279 ILPPFNSNSLEDVLSRLNADSLDDSLKQAMPRE-------------------------------- 311
            :||  :...::.|.:.|..::|....::.:||:                                
  Rat   277 VLP--DPGKMQQVEAALQPETLRRWGQRFLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHL 339

  Fly   312 --------IEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLT------SETISIGDSKH 362
                    :::.||:|.......|..||..:|:|.:||...    ||:      ::|:|  ...|
  Rat   340 QMTQTWSLLDLHLPRFSVSATYNLEEILPLVGLSSLFDVEA----DLSGIMGQLNKTVS--RVSH 398

  Fly   363 VAKIKVDEEGSTAAAATVLFTYRSARPVEPAKF-ECNHPFLFVIYDRTSRSILFTGIYRDP 422
            .|.:.::|:|:.||||:.|.:...:..:..|.. ..|.|||.::::.|::|:||.|...:|
  Rat   399 KAVVDMNEKGTEAAAASGLLSQPPSLNMTSAPHAHFNRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 98/446 (22%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 98/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.