DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpinb9

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:401 Identity:126/401 - (31%)
Similarity:203/401 - (50%) Gaps:44/401 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEV 100
            |.:....||:.:|.::.||.|:|||.:||.|...||.:...|:.|.|:.::::.|.|:  ..|::
  Rat    26 LSEANGTFAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQALGLN--KEKDL 88

  Fly   101 VRS-AYILEKMNRKERQSKMPLEFSSADRIFFANDLHV-----TECAR--NRLAEEVQQIDFKSQ 157
            .:. ..:|..:|:.||:..:.:    |:|:|......:     ..|.|  |   .|::|:.|...
  Rat    89 HQGFQLLLSNLNKPERKYSLRV----ANRLFADKTCELLPTYKESCLRFYN---SEMEQLSFAEA 146

  Fly   158 TEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSP 222
            .|||||.||.|::|||..:|..:||...:...|||||.||.|.||:|...|..|.||.|||..:.
  Rat   147 AEESRKHINTWVSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINK 211

  Fly   223 SNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNS 287
            :...||.||..:.|:.|...::::|.||.:||               |..::|.|::||. |...
  Rat   212 NEKRLVQMMCCEDTYNLAHVKEVQAQVLMMPY---------------EGMELSFVVLLPD-NDGD 260

  Fly   288 LEDVLSRLNADSL-----DDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATF 347
            |..|.|.|..:.|     .|.:|..   .:||.||||:.::..::..:..::|:..:|.|:.|..
  Rat   261 LSKVESNLTFEKLTAWTNPDFMKNT---NVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADL 322

  Fly   348 DDLTSE-TISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSR 411
            ..::.| .:.:....|.:.::|:|||:.||||:.:..|..|..|  ..|..:|||||.|....:.
  Rat   323 SAMSPERNLCVSKIVHKSLVEVNEEGTEAAAASAVIEYCCAAFV--PTFCADHPFLFFIKHNKTN 385

  Fly   412 SILFTGIYRDP 422
            ||||.|.:..|
  Rat   386 SILFCGRFSSP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 124/393 (32%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 125/399 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.