DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and CG43366

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:530 Identity:98/530 - (18%)
Similarity:185/530 - (34%) Gaps:137/530 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHILSISLMAVLPAIAL----AGLCGVEPDAGLLDQRLNLYKGQQN-FAVSMLNVI--RQSTPNE 58
            :::::.|..:..|.:.|    ....|:|....::|:.|..:....| .|.|....|  .:.:...
  Fly  1642 INLMASSTQSTRPPVKLDPSPESSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSAR 1706

  Fly    59 NVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD-------------------WADSKEVVRSA 104
            ::..||::....|.:.:.|:.|.|..|:.::|.||                   .|...::..:|
  Fly  1707 SLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFNPHLIFKNITNSVEQASDSDIATAA 1771

  Fly   105 YILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWI 169
            ::.|..:.:.....:|         ||      .|..:...|..|::::|....:..|::.|..:
  Fly  1772 FVREIFSDRANGKILP---------FF------KEKTQQLYAGHVEEVNFHVVNDIVRRRTNLLV 1821

  Fly   170 AKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPS--NYSLV---S 229
            .:.|..::...|..:.:.....|...:|...:........|::...|.|...|:  ...||   :
  Fly  1822 KRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPA 1886

  Fly   230 MMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSN-SLEDVLS 293
            ::.:.| ||...:..|.|.|:               |.....:.:|.|.::|...|: |..|.|.
  Fly  1887 VLYRSG-FLAGYEPSLDATVV---------------SFGRVQNTVSTVYVMPGHQSSISPMDNLD 1935

  Fly   294 RLNADSLDDSL--KQAMPR---------EIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATF 347
            ||....::.:.  |||..|         .:||.||:|.....:..:..|.|||:..:|....|..
  Fly  1936 RLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLRGLFKSDFADL 2000

  Fly   348 DDLT---------SETISI------GDSK-----HVAKI-------------KVDEEGSTAAAAT 379
            ..||         |:.|.|      |:.|     ||...             ..|::...::...
  Fly  2001 RGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATDDDAFDSSERV 2065

  Fly   380 VLF--------------------TY---------RSARPVEPAKFECNHPFLFVIYDRTSRSILF 415
            |.|                    .|         |.||..:..:...:.|||:.:....:..|||
  Fly  2066 VDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFVRHNPTGMILF 2130

  Fly   416 TGIYRDPKTI 425
            .|.: :|:.:
  Fly  2131 MGRF-NPRLL 2139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 90/480 (19%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 90/480 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.