DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Spn31A

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster


Alignment Length:405 Identity:104/405 - (25%)
Similarity:163/405 - (40%) Gaps:109/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKER 115
            |..|...:||..||......|.|.:.||.|.|.:||.|.|.|                    |:|
  Fly    22 IATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL--------------------KQR 66

  Fly   116 QSKMPLEFSSADRI--FFANDL-HVTECA------RNRL--------AEEVQQI----------- 152
                   |:|..::  |:|.:| ::|..|      :|||        |::.|:|           
  Fly    67 -------FASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAEC 124

  Fly   153 -DFKSQTEESRKQINDWIA--------KQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQF 208
             |.: |||:.|:.|::.|.        |..|  :....||:      .|:|..||.|:.:|...|
  Fly   125 VDLE-QTEKLRRHISEQILASVGGGSWKDIH--VAGGSSAN------TLLLLLAANLQSKWFLPF 180

  Fly   209 KTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVD-EQLRAHVLQLPYRTVFESQEKEDSSPDENS 272
            ...:|....|: |.|....|.|:.....|:...: ..|.|..::|||              :...
  Fly   181 SAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPY--------------EHAE 230

  Fly   273 DISMVLILPPFNSNSLEDVLSRLNADSLD-DSLKQAMPRE-IEVSLPKFEFEQRLELNPILAKMG 335
            ::||:||||. ....|:::..:|:  .|| .:|:|.|..| ::|.||||..:....|...|.::|
  Fly   231 ELSMLLILPN-QRGGLQELEKQLH--DLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLG 292

  Fly   336 VSKMFDESVATFDDL-TSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAK----- 394
            ..::|..| |.|..| .|..:.|.|.....:|.::|.||.:.....    ::|...:|..     
  Fly   293 FEEIFAAS-ANFKHLHASANLPIADVLQKLRINLNESGSGSGPELP----KNATEYKPIVISNSS 352

  Fly   395 ----FECNHPFLFVI 405
                |..:|||.|.|
  Fly   353 RQKFFRADHPFFFAI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 104/405 (26%)
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 104/405 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.