DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Spn28Da

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:424 Identity:115/424 - (27%)
Similarity:181/424 - (42%) Gaps:76/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LCGVEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEK 84
            ||.:.....:|.|          |...:.....|.....|:..||......:.:...|:.|:|..
  Fly     4 LCWILVTTSVLGQ----------FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTAN 58

  Fly    85 ELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLAEEV 149
            ||...|:|. .|.|.|   |.|.:|:..|..:.|.......|:|:|....:.|.: ..|:|..: 
  Fly    59 ELRTALNLP-EDKKNV---ATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNK-RYNKLVNK- 117

  Fly   150 QQIDFKSQTE--------ESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLS 206
               .|:::.|        ::...||||:..||.|.:::::...::||....|:.|||:.||.|.:
  Fly   118 ---HFRAEAEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKT 179

  Fly   207 QFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLL---NVDEQLRAHVLQLPYRTVFESQEKEDSSP 268
            :|....|.|..||.|.|....|:||.|.|.|.:   .:|:     :::||:              
  Fly   180 RFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQ-----IIELPF-------------- 225

  Fly   269 DENSDISMVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPRE--IEVSLPKFEFEQRLELNPIL 331
             ..|::|||::||..|.       |...|::..:|..|.:..|  :.|.||||:.:.|:||...|
  Fly   226 -AYSNLSMVIVLPKDNG-------SLTQAEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETL 282

  Fly   332 AKMGVSKMFDESVATFDDLTSETISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPV------ 390
            ..||:..:|:.|......|......|....|.|.|::||||.:|.:|       ||.|:      
  Fly   283 KSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSA-------SASPIRGLSDY 340

  Fly   391 --EPAKFECNHPFLFVIYDRTSRSILFTGIYRDP 422
              ....|..|.||:|:|  |...:|.|.|...||
  Fly   341 ATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 109/400 (27%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 110/407 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.