DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn88Ea and Serpine3

DIOPT Version :9

Sequence 1:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:401 Identity:88/401 - (21%)
Similarity:162/401 - (40%) Gaps:57/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDW 94
            |.:.|.|.|.:  ||:.:...........|...||.|...:|.:..||:.|:|..:||..|....
Mouse    24 LSEGLWLLKTE--FALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTV 86

  Fly    95 ADS--KEVVRSAYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTECARNRLA----EEVQQID 153
            .|.  ||.:.:.|      .....|...:....|..:|......::.|...:::    ..::..|
Mouse    87 QDPRVKEFLHAVY------TTRHNSSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAAD 145

  Fly   154 F---KSQTEESRKQINDWIAKQTHDQIRNML--SADEITPRTRLVLANAAYLKGQWLSQFKTEKT 213
            |   .|.|.|:.|..:   .:.|.:...:.|  .||.::  |:|.:.:....:..|..:|.. ..
Mouse   146 FSEPNSTTTEASKVTS---RQSTGEGPDSPLWGRADALS--TQLSIMSTMTFQSTWQKRFSV-VL 204

  Fly   214 VPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAH---VLQLPY--RTVFESQEKEDSSPDENSD 273
            .|:||..:......|..|.|.........:....|   ||:|.|  |..                
Mouse   205 QPLPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVA---------------- 253

  Fly   274 ISMVLILPPFNSNSLEDVLSRLNADSL---DDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMG 335
             |::|:||......|:.:...|.|..|   ...||:|   .::|.||:|:.:.:.::..||...|
Mouse   254 -SLLLVLPQDKGTPLDHIEPHLTARVLHLWTTRLKRA---RMDVFLPRFKIQNQFDVKSILRSWG 314

  Fly   336 VSKMFDESVATFDDLTSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNH 399
            ::.:||...|....::.:. ..:....|.||:::.|||:.::|||.:...|.:|   .:.|:.:.
Mouse   315 ITDLFDPLKANLKGISGQDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSR---TSAFKADR 376

  Fly   400 PFLFVIYDRTS 410
            ||:|::.:.::
Mouse   377 PFIFLLREHST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 84/392 (21%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 88/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.